DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk14

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:269 Identity:95/269 - (35%)
Similarity:140/269 - (52%) Gaps:37/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGA-TPTPGDGRIVGGEVATIQEFPYQVSVQLQGRH--ICGGAIIGIDTVLTAAHCFE 71
            |:.|.|.|.| ..:.||.:|:||........|:||::|....|  :|||.::....|:|||||  
Mouse     5 LIILQALAVAIAQSQGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAHC-- 67

  Fly    72 DPWSSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
                 |...:.|...:|     |:...|:.:.|.:.|..|.||:|||||.||.|..::.....::
Mouse    68 -----ARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKKVRLGRAVK 127

  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYSQVLPI 195
            .:.:|:....|  .|..:|||||      .::..:...| .|:.|:|:::....|.|||..:  |
Mouse   128 TISVASSCASP--GTPCRVSGWG------TIASPIARYPTALQCVNVNIMSEQACHRAYPGI--I 182

  Fly   196 TRRMICAARP--GRDSCQGDSGGPLV-GYAAEEGPARLYGIVSWGL-GCANPNFPGVYTNVAAFR 256
            |..|:||..|  |:|||||||||||| |       .:|.|:||||: .||.|.:||||.|:..:.
Mouse   183 TSGMVCAGVPEGGKDSCQGDSGGPLVCG-------GQLQGLVSWGMERCAMPGYPGVYANLCNYH 240

  Fly   257 SWIDEQLDA 265
            |||...:.:
Mouse   241 SWIQRTMQS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 86/243 (35%)
Tryp_SPc 28..262 CDD:238113 88/245 (36%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 88/245 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.