DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk15

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:272 Identity:89/272 - (32%)
Similarity:129/272 - (47%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATPTPGDG-RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF 70
            :|.|:|.|....|..   || :::.||.......|:||::..:||..||..:|....||||||| 
Mouse     1 MWLLLAFVLLVSAAQ---DGDKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTAAHC- 61

  Fly    71 EDPWSSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHL 130
                .:....||:|  ||     :....:.|:.|:|.|..|..::|.:|:.||.|......|.::
Mouse    62 ----QTRFMRVRLG--EHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAYV 120

  Fly   131 QPVPLAALADPPTADTRLQVSGWGFQAEES-----AVSGEVGVSPQLRFVDVDLVESNQCRRAY- 189
            :||.|....  |.......|||||..::.:     :....|.:...|...::.::....|.:.| 
Mouse   121 RPVALPRRC--PLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKDYP 183

  Fly   190 SQVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LGCANPNFPGVYTN 251
            .:|||   .|:||.  ..|.|||:||||||||...|      |.|||||| :.|.....|||||.
Mouse   184 GRVLP---TMVCAGVEGGGTDSCEGDSGGPLVCGGA------LQGIVSWGDVPCDTTTKPGVYTK 239

  Fly   252 VAAFRSWIDEQL 263
            |.::..||.|.:
Mouse   240 VCSYLEWIWENV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/245 (32%)
Tryp_SPc 28..262 CDD:238113 81/247 (33%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.