DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG6041

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:282 Identity:92/282 - (32%)
Similarity:145/282 - (51%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGA--------TPTPG--DGRIVGGEVATIQEFPYQVSVQLQGR--------HIC 53
            :|.::|:..:.||        :.|.|  :.:||||..|:|::..||||::|...        |:|
  Fly     4 VWAILAIALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLC 68

  Fly    54 GGAIIGIDTVLTAAHCF-----EDPWSSADYTVRVGSSEHESGGH---VLSLRRVIAHGDYNPQS 110
            ||.:|....|.|||||.     :...::.::.:.:||:...|...   :..|:::|.|.:|||.:
  Fly    69 GGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDA 133

  Fly   111 HDNDLALLILNGQLNFTEHLQPVPLAALADPPTA-DTRLQVSGWGFQAEESAVSGEVGVSPQLRF 174
            ..||:||:.:||.:.:  :...|...||.....| :|...:||||...:....|     |..|:.
  Fly   134 LTNDIALMFINGYIPW--NWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFS-----SNTLQA 191

  Fly   175 VDVDLVESNQCRRAYSQVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG 237
            ..|.:|....||.:|:.: |:::  :||.  ..|.|:||||||||:      .....|.||||:|
  Fly   192 ATVPIVSYTTCRISYNSI-PVSQ--VCAGYLSGGVDACQGDSGGPM------SCNGMLAGIVSYG 247

  Fly   238 LGCANPNFPGVYTNVAAFRSWI 259
            .|||.|.:|||||||:.:..||
  Fly   248 AGCAAPGYPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 84/250 (34%)
Tryp_SPc 28..262 CDD:238113 86/251 (34%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 84/250 (34%)
Tryp_SPc 35..272 CDD:238113 86/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.