DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prtn3

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:277 Identity:84/277 - (30%)
Similarity:116/277 - (41%) Gaps:67/277 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQ---GRHICGGAIIGIDTVLTAAHCFED 72
            :|.|.:.||...   .:||||..|.....||..|:||.   |.|.|||.:|....|||||||.:|
  Rat   184 LAGVRFHGAVQA---SKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHCLQD 245

  Fly    73 -PWSSADYTVRVG-----SSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
             .|...  ||.:|     |||.|.....::   .:...:|||:...||:.||.||         :
  Rat   246 ISWQLV--TVVLGAHDLLSSEPEQQKFTIT---QVFENNYNPEETLNDVLLLQLN---------R 296

  Fly   132 PVPL---AALADPPTAD------TRLQVSGW---GFQAEESAVSGEVGVSPQLRFVDVDLVESNQ 184
            |..|   .|:|..|..|      |:....||   |.:|....|..|:.|:          |.:..
  Rat   297 PASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVT----------VVTFL 351

  Fly   185 CRRAYSQVLPITRRMICAARPGRDS--CQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFP 246
            ||          ...:|...|.|.:  |.|||||||:....      |:|:.|:.: .||:..||
  Rat   352 CR----------EHNVCTLVPRRAAGICFGDSGGPLICNGI------LHGVDSFVIRECASLQFP 400

  Fly   247 GVYTNVAAFRSWIDEQL 263
            ..:..|:.:.:||...|
  Rat   401 DFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 77/255 (30%)
Tryp_SPc 28..262 CDD:238113 79/257 (31%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.