DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and LOC312273

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:262 Identity:94/262 - (35%)
Similarity:125/262 - (47%) Gaps:38/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVAYAGATPT-PGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSS 76
            |:....|.|| ..|.|||||........|||||:. .|.|||||::|....||:||||:.     
  Rat     9 LLGTVAAFPTEDNDDRIVGGYTCQEHSVPYQVSLN-AGSHICGGSLITDQWVLSAAHCYH----- 67

  Fly    77 ADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLA 136
            ....||:|  ||     |.....:...::|.|.||:..:.|||:.|:.|.........:..:||.
  Rat    68 PQLQVRLG--EHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLP 130

  Fly   137 ALADPPTADTRLQVSGWG---FQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRR 198
            ...  |||.|...|||||   |..|..:|         |:.:|..::..:.|.:||.:  .||..
  Rat   131 QYC--PTAGTECLVSGWGVLKFGFESPSV---------LQCLDAPVLSDSVCHKAYPR--QITNN 182

  Fly   199 MICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261
            |.|..  ..|:||||.|||||:|      ....:.||||||.|||....|||||.|..:.:||.:
  Rat   183 MFCLGFLEGGKDSCQYDSGGPVV------CNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQ 241

  Fly   262 QL 263
            .:
  Rat   242 TI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 87/241 (36%)
Tryp_SPc 28..262 CDD:238113 88/243 (36%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.