DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG3795

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:244 Identity:69/244 - (28%)
Similarity:105/244 - (43%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YQVSVQLQGR--------HICGGAIIGIDTVLTAAHCF---EDPWSSADYTVRVGSSEH---ESG 91
            |.||::: |:        |.|.|.|.....:||||||.   .....:....|..|:...   .|.
  Fly    60 YTVSLRM-GKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSST 123

  Fly    92 GHVLSLRRVIAHGDYNP-QSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGF 155
            ..::....::.|..|.. :|...|:.|::|...|:..:.:..:||  ....|.|.....:.|||.
  Fly   124 TQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPL--YNKVPVAGAPCSIVGWGT 186

  Fly   156 QAE-----ESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICA---ARPGRDSCQG 212
            ..:     :.|::|::.:.|. .|.:..|..||             ..|:||   .....|||||
  Fly   187 VIQFGPLPDEAINGDMQILPD-TFCEKLLGWSN-------------AGMLCANDKHDSDVDSCQG 237

  Fly   213 DSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261
            ||||||:      ....:.||||:|:||..|:..|:||:|..||.||.|
  Fly   238 DSGGPLI------CDNMVTGIVSFGMGCGEPDSAGIYTDVYHFRDWITE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 66/240 (28%)
Tryp_SPc 28..262 CDD:238113 69/244 (28%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 69/244 (28%)
Tryp_SPc 60..278 CDD:214473 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.