DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss30

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:324 Identity:108/324 - (33%)
Similarity:145/324 - (44%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YSTKFLWWLMALVAYAGATPTP-----------------------GD------------GRIVGG 31
            ||...|.||::.....|:||.|                       ||            |:||||
Mouse    13 YSQSQLQWLLSEGWALGSTPHPQWIVDGLTLRRSYAGFFYNGWARGDILPSVCGHSRDAGKIVGG 77

  Fly    32 EVATIQEFPYQVSVQL-QGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGS---SEHESGG 92
            :.|...::|:|||:.: :..|||||::|....||||||||....:.:.|.|:||.   |..|...
Mouse    78 QDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHS 142

  Fly    93 HVLSLRRVIAHGDYN-PQSHDNDLALLILNGQL---NFTEHLQPVPLAALADPPTADTRLQVSGW 153
            .::::|.:..|..|. ..:...|:||:.|:..|   .||    ||.|.|...|.|..|...|:||
Mouse   143 TLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFT----PVCLPAAQTPLTPGTVCWVTGW 203

  Fly   154 GFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAY-------SQVLPITRRMICA--ARPGRDS 209
            |...|....|       .|:.:.|.|::|..|.:.|       |....|...|:||  ....:||
Mouse   204 GATQERDMAS-------VLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQKDS 261

  Fly   210 CQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL-----DARGW 268
            ||||||||||  .:........||.|||:|||.|..|||||.|..:..||...|     ||.|:
Mouse   262 CQGDSGGPLV--CSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHSDAYGY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 90/248 (36%)
Tryp_SPc 28..262 CDD:238113 92/250 (37%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 92/250 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.