DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk12

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:271 Identity:87/271 - (32%)
Similarity:126/271 - (46%) Gaps:56/271 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHI-CGGAIIGIDTVLTAAHCFEDP 73
            ::.|:...|.:....: :|..|........|:||.: ..|::: |||.::....|||||||    
  Rat     5 ILLLLCVVGLSQADRE-KIYNGVECVKNSQPWQVGL-FHGKYLRCGGVLVDRKWVLTAAHC---- 63

  Fly    74 WSSADYTVRVGSSEHESGG---------HVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129
              |..|.||:|  ||....         ...|:.....||.|  |:|::||.||.||..::.|..
  Rat    64 --SGKYMVRLG--EHSLSKLDLTEQLRLTTFSITHPSYHGAY--QNHEHDLRLLRLNRPISLTYA 122

  Fly   130 LQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP------QLRFVDVDLVESNQCRRA 188
            ::||.|.:...|..|  :..:||||...:           |      :|:.:|:.:|.:..||  
  Rat   123 VRPVALPSSCAPTGA--KCHISGWGTTNK-----------PWDPFPDRLQCLDLSIVSNETCR-- 172

  Fly   189 YSQVLP--ITRRMICA-ARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LG-CANPNFPGV 248
              .|.|  :|..|:|| ...|:|:||||||||||....      |.|:|||| :| |.....|||
  Rat   173 --AVFPGRVTENMLCAGGEAGKDACQGDSGGPLVCGGV------LQGLVSWGSVGPCGQKGIPGV 229

  Fly   249 YTNVAAFRSWI 259
            ||.|..:..||
  Rat   230 YTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 83/252 (33%)
Tryp_SPc 28..262 CDD:238113 85/253 (34%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.