DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk9

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:268 Identity:84/268 - (31%)
Similarity:125/268 - (46%) Gaps:47/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDP--WS 75
            |..:.||     |.|.||.........|:|..:....|.:||..:|....:|||||| ..|  | 
  Rat    13 LAGHCGA-----DTRAVGARECQRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHC-RKPYLW- 70

  Fly    76 SADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNP----QSHDNDLALLILNGQLNFTEHLQ 131
                 ||:|  ||     |....:|.:.....|..:||    ..|::|:.|:.|..::..:..:|
  Rat    71 -----VRLG--EHHLWQWEGPEKLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLSPAVQ 128

  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP-- 194
            |:.|:  ...|:..|:..:||||     |..|.::.....|:..::.::::..||.||    |  
  Rat   129 PLNLS--QSLPSVGTQCLISGWG-----SVSSSKIQFPMTLQCANISILDNKLCRWAY----PGH 182

  Fly   195 ITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFPGVYTNVAAFR 256
            |:.:|:||.  ..||.|||||||||||      ....|.||||.|. .|:.|..|.|||:|..:.
  Rat   183 ISEKMLCAGLWEGGRGSCQGDSGGPLV------CKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYL 241

  Fly   257 SWIDEQLD 264
            .||:..::
  Rat   242 DWIENTVE 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 78/247 (32%)
Tryp_SPc 28..262 CDD:238113 79/249 (32%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 79/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.