DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk10

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:273 Identity:86/273 - (31%)
Similarity:117/273 - (42%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFE 71
            ||...||: ..|.| |..|....|....::.: |:|||:....:..|.|.::..:.|||||||  
  Rat    29 LWAAQALL-LPGNT-TREDLEAFGTLCPSVSQ-PWQVSLFHNLQFQCAGVLVDQNWVLTAAHC-- 88

  Fly    72 DPWSSADYTVRVGSSEHESGGHVL--------SLRRVIAHGDYNP--------QSHDNDLALLIL 120
              |.:.....|||..      |:|        |....:.|..|.|        :|.::||.:|.|
  Rat    89 --WRNKPLRARVGDD------HLLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLKL 145

  Fly   121 NGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQC 185
            :..:..|..:.||.|......|..:  .||||||..|..     .|..:..|....|.|:...||
  Rat   146 SSPVVLTSKVHPVQLPFQCAQPRQE--CQVSGWGTTANR-----RVKYNRSLSCSRVTLLSQKQC 203

  Fly   186 RRAYSQVLPITRRMICAARP-GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGL---GCANPNFP 246
            ...|..|  ||..||||... .:||||.|||||||      ....|:||:||.:   |.|. .:|
  Rat   204 ETFYPGV--ITNNMICAGMDRDQDSCQSDSGGPLV------CDNTLHGILSWSIYPCGAAT-QYP 259

  Fly   247 GVYTNVAAFRSWI 259
            .||..:..:.:||
  Rat   260 AVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 76/251 (30%)
Tryp_SPc 28..262 CDD:238113 78/252 (31%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.