DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk11

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:262 Identity:88/262 - (33%)
Similarity:126/262 - (48%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VGGEVATIQEF-------PYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSS 86
            ||||...|:.:       |:||::..:.|.:||..:|....:||||||     ....|.:.:|  
  Rat    45 VGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHC-----RKPHYVILLG-- 102

  Fly    87 EH---ESGGHVLSLRRV----IAHGDYN----PQSHDNDLALLILNGQLNFTEHLQPVPLAALAD 140
            ||   ::.|  ...||:    ..|..:|    .:.|.||:.|:.::.....|..::|:.|::|. 
  Rat   103 EHNLEKTDG--CEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMSSPAFITRAVRPLTLSSLC- 164

  Fly   141 PPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRF------VDVDLVESNQCRRAYSQVLP--ITR 197
             .||.|...:||||..:           |||||.      .:|.::...:|.|||    |  ||.
  Rat   165 -VTAGTSCLISGWGTTS-----------SPQLRLPHSLRCANVSIIGHKECERAY----PGNITD 213

  Fly   198 RMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLG-CANPNFPGVYTNVAAFRSWI 259
            .|:||:  :.|:||||||||||||...:      |.||:|||.. ||....|||||.|..:..||
  Rat   214 TMLCASVRKEGKDSCQGDSGGPLVCNGS------LQGIISWGQDPCAVTRKPGVYTKVCKYFDWI 272

  Fly   260 DE 261
            .|
  Rat   273 HE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/258 (33%)
Tryp_SPc 28..262 CDD:238113 88/262 (34%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 81/253 (32%)
Tryp_SPc 51..275 CDD:238113 84/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.