DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss34

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:284 Identity:95/284 - (33%)
Similarity:140/284 - (49%) Gaps:45/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATP--TPGDGR----IVGGEVATIQEFPYQVSVQL------QGRHICGGAIIG 59
            ||:|...:...|:|.  ||..|:    ||||...:...||:|||::.      :..|||||::|.
  Rat     6 LWFLFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIH 70

  Fly    60 IDTVLTAAHCFE-DPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQ---SHDNDLALLIL 120
            ...|||||||.| ....::.:.|:||.........::.:.::|.|..::.:   ....|:|||.|
  Rat    71 PQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADIALLKL 135

  Fly   121 NGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESN 183
            :..:..:|.:.||.|.|.:...::.....|:|||      .:.|...:.|  .||.|.|.:|.::
  Rat   136 DSTVVLSERVHPVSLPAASQRISSKKTWWVAGWG------VIEGHRPLPPPCHLREVAVPIVGNS 194

  Fly   184 QCRRAYSQVLPITRR-------MICAARPGRDSCQGDSGGPLVGYAAEEGPAR------LYGIVS 235
            .|.:.|.....:.|.       |:||...||||||.|||||||        .|      ..|:||
  Rat   195 DCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDSCQADSGGPLV--------CRWNCSWVQVGVVS 251

  Fly   236 WGLGCANPNFPGVYTNVAAFRSWI 259
            ||:||..|:||||||.|.::.|||
  Rat   252 WGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/260 (33%)
Tryp_SPc 28..262 CDD:238113 87/257 (34%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 87/257 (34%)
Tryp_SPc 33..275 CDD:214473 85/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.