DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss29

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:255 Identity:91/255 - (35%)
Similarity:128/255 - (50%) Gaps:29/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGEVATIQEFPYQVSVQL------QGRHICGGAIIGIDTVLTAAHCFEDPWSSAD---YTVRV 83
            ||||..|...::|:|||:::      ...|||||:||....|||||||..:  |.||   :.:.:
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHE--SDADPSAFRIYL 93

  Fly    84 GSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRL 148
            |......|..:|.:.|||.|.|:......:|:|||.|...:....:::||.|:..:...|.....
  Rat    94 GQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTKKDVC 158

  Fly   149 QVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCRRAYSQVLPITRR--------MICAA 203
            .|:|||      :||....:.|  :|:.|.|.:|::..|.:.|.....::..        |:||.
  Rat   159 WVTGWG------SVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAG 217

  Fly   204 RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263
            ..|||||.||||||||  ....|...|.|:||||.|||..:.||||..|..|..||..|:
  Rat   218 SHGRDSCYGDSGGPLV--CNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 88/249 (35%)
Tryp_SPc 28..262 CDD:238113 90/252 (36%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.