DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and LOC286960

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:265 Identity:87/265 - (32%)
Similarity:128/265 - (48%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSS 76
            |.:..|.|.|...|.:||||........|||||:.....|.|||::|....||:||||::     
  Rat     8 AFLGAAVALPVNDDDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYK----- 67

  Fly    77 ADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALL------ILNGQLNFTEHL 130
            ....||:|  ||     |.|...:...::|.|.:||..:.|||:.|:      :||.|::...  
  Rat    68 RKLQVRLG--EHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVS-- 128

  Fly   131 QPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPI 195
              :|.:.    .:.|.:..|||||   ...::.|:  ....|:.::..::.::.|:::|..  .|
  Rat   129 --LPRSC----ASTDAQCLVSGWG---NTVSIGGK--YPALLQCLEAPVLSASSCKKSYPG--QI 180

  Fly   196 TRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSW 258
            |..|.|..  ..|:|||.||||||:|      ....:.||||||..||....|||||.|..:.||
  Rat   181 TSNMFCLGFLEGGKDSCDGDSGGPVV------CNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSW 239

  Fly   259 IDEQL 263
            |.|.:
  Rat   240 IQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 79/244 (32%)
Tryp_SPc 28..262 CDD:238113 81/246 (33%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 79/244 (32%)
Tryp_SPc 24..243 CDD:238113 81/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.