DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Tpsg1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:268 Identity:96/268 - (35%)
Similarity:136/268 - (50%) Gaps:26/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHESG 91
            |||||..|....:|:|.|::|...|:|||:::..:.||||||||....:|:||.|.:|.......
Mouse    86 RIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELTVTLS 150

  Fly    92 GHVLSLRRVIAH-GDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGF 155
            .|..:::|:|.: |...|.....|:||:.|:..:..:..:|||.|...:.......:..|:|||:
Mouse   151 PHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGMQCWVTGWGY 215

  Fly   156 QAEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYSQVLP----ITRRMICAARPGRDSCQGDSG 215
            ..|     ||....| .|:...|.:|:...|.:||:.  |    |...|:||..|| |:||.|||
Mouse   216 TGE-----GEPLKPPYNLQEAKVSVVDVKTCSQAYNS--PNGSLIQPDMLCARGPG-DACQDDSG 272

  Fly   216 GPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDARG--------WDELL 272
            ||||...|  |..:..|:||||.||..|:.||||..|.|:.:||...:...|        |..||
Mouse   273 GPLVCQVA--GTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAGGSGMQGLPWAPLL 335

  Fly   273 AG--WSRL 278
            |.  |..|
Mouse   336 AALFWPSL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 87/237 (37%)
Tryp_SPc 28..262 CDD:238113 88/239 (37%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 88/239 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.