DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS33

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:278 Identity:104/278 - (37%)
Similarity:139/278 - (50%) Gaps:37/278 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVAYAGATPTPG-----------DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTA 66
            |:...||..|.|           ..|||||......|:|:|.|:|.:|.|:|||::|....||||
Human    11 LLLVLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSLIAPQWVLTA 75

  Fly    67 AHCFEDPWSSADYTVRVGSSE-HESGGHVLS--LRRVIAHGDYNPQSHDNDLALLILNGQLNFTE 128
            ||||......|:|.||:|:.. ..:....||  :|||:...||:......|||||.|...:..:.
Human    76 AHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQLRRPVPLSA 140

  Fly   129 HLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVS-PQ---LRFVDVDLVESNQCRRAY 189
            .:|||.|......|...|..:|:|||        |...||. |:   |:.|.|.|::|..|...|
Human   141 RVQPVCLPVPGARPPPGTPCRVTGWG--------SLRPGVPLPEWRPLQGVRVPLLDSRTCDGLY 197

  Fly   190 --SQVLPITRRMI-----CAARP--GRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNF 245
              ...:|...|::     ||..|  .:|:|||||||||.  ..:.|...|.|:||||.|||.||.
Human   198 HVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLT--CLQSGSWVLVGVVSWGKGCALPNR 260

  Fly   246 PGVYTNVAAFRSWIDEQL 263
            |||||:||.:..||..::
Human   261 PGVYTSVATYSPWIQARV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 97/247 (39%)
Tryp_SPc 28..262 CDD:238113 98/249 (39%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 97/247 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.