DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss2

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_036861.1 Gene:Prss2 / 25052 RGDID:3418 Length:246 Species:Rattus norvegicus


Alignment Length:262 Identity:91/262 - (34%)
Similarity:133/262 - (50%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWS 75
            :|||..|.|.|...|.:||||........|||||:. .|.|.|||::|....|::||||::    
  Rat     7 LALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYK---- 66

  Fly    76 SADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPL 135
             :...||:|  ||     |.....::..::|.|.:::.::.:||:.|:.|:..:.....:..|.|
  Rat    67 -SRIQVRLG--EHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVAL 128

  Fly   136 AALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMI 200
            .:...|  |.|:..:||||     :.:|..|.....|:.:|..|:....|..:|..  .||..|:
  Rat   129 PSSCAP--AGTQCLISGWG-----NTLSSGVNEPDLLQCLDAPLLPQADCEASYPG--KITDNMV 184

  Fly   201 CAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQL 263
            |..  ..|:||||||||||:|      ....|.||||||.|||.|:.|||||.|..:..||.:.:
  Rat   185 CVGFLEGGKDSCQGDSGGPVV------CNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTI 243

  Fly   264 DA 265
            .|
  Rat   244 AA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 81/238 (34%)
Tryp_SPc 28..262 CDD:238113 83/240 (35%)
Prss2NP_036861.1 Tryp_SPc 23..239 CDD:214473 81/238 (34%)
Tryp_SPc 24..242 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.