DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and TPSD1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:232 Identity:80/232 - (34%)
Similarity:111/232 - (47%) Gaps:33/232 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDG----RIVGGEVATIQEFPYQVSVQLQG---RHICGGAIIGIDTVLTAA 67
            |..|.:.|...|.||..    .||||:.|...::|:|||::::|   .|.|||::|....|||||
Human    16 LPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAA 80

  Fly    68 HCFE-DPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
            ||.| |....|...|::..........:|.:.|:|.|..:.......|:|||.|...:|.:.|:.
Human    81 HCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIH 145

  Fly   132 PVPLAALADPPTADT-----RLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCRRAY 189
            .|.|     ||.::|     ...|:|||      .|...|.:.|  .|:.|:|.:||::.|...|
Human   146 TVTL-----PPASETFPPGMPCWVTGWG------DVDNNVHLPPPYPLKEVEVPVVENHLCNAEY 199

  Fly   190 SQVL------PITR-RMICAARPGRDSCQGDSGGPLV 219
            ...|      .|.| .|:||.....||||||||||||
Human   200 HTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 74/211 (35%)
Tryp_SPc 28..262 CDD:238113 74/210 (35%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 74/210 (35%)
Tryp_SPc 38..240 CDD:214473 74/210 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.