DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss40

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_033382.2 Gene:Prss40 / 21756 MGIID:1270857 Length:365 Species:Mus musculus


Alignment Length:256 Identity:81/256 - (31%)
Similarity:132/256 - (51%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSS 86
            |...|:|.||::|..:.:|:|.|::|.||||||..:|..:.||:|||||:.....:||.|.:|.:
Mouse    63 TKFQGKIYGGQIAGAERWPWQASLRLYGRHICGAVLIDKNWVLSAAHCFQRSQEPSDYHVMLGYT 127

  Fly    87 EHESG---GHVLSLRRVIAHGDYNP-QSHDNDLALLILNGQLNFTEHLQP--VPLAALADPPTAD 145
            :..|.   ...:|:::||.|.|||. .:..:|:.||.|...:.::.|:.|  ||...:..|  .:
Mouse   128 DLNSPTRYSRTMSVQKVIVHKDYNRFHTQGSDIVLLQLRSSVEYSSHILPACVPEENIKIP--KE 190

  Fly   146 TRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRR-------MICAA 203
            .....||||:..|:.    .:.:..:|...::.::.::||:..:...:|.:.|       |:|||
Mouse   191 KACWASGWGYLREDV----RIPLPNELYEAELIIMSNDQCKGFFPPPVPGSGRSYYIYDDMVCAA 251

  Fly   204 --RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNF-PGVYTNVAAFRSWIDE 261
              ...:..|.||||||||  ...||...:.|:.||...|..|.. |.|:..|:.|..||.:
Mouse   252 DYDMSKSICAGDSGGPLV--CLLEGSWYVVGLTSWSSTCEEPIVSPSVFARVSYFDKWIKD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 77/247 (31%)
Tryp_SPc 28..262 CDD:238113 79/250 (32%)
Prss40NP_033382.2 Tryp_SPc 68..308 CDD:214473 77/247 (31%)
Tryp_SPc 69..311 CDD:238113 79/250 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6460
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.