DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prtn3

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:280 Identity:92/280 - (32%)
Similarity:122/280 - (43%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQ---GRHICGGAIIGIDTVLTAAHCFE 71
            |:|||. .||...   .:||||..|.....||..|:||.   |.|.|||.:|....|||||||.:
Mouse    16 LLALVV-GGAVQA---SKIVGGHEARPHSRPYVASLQLSRFPGSHFCGGTLIHPRFVLTAAHCLQ 76

  Fly    72 D-PWSSADYTVRVG-----SSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHL 130
            | .|...  ||.:|     |||.|.....:|   .:...:|||:.:.||:.||    |||.|..|
Mouse    77 DISWQLV--TVVLGAHDLLSSEPEQQKFTIS---QVFQNNYNPEENLNDVLLL----QLNRTASL 132

  Fly   131 -QPVPLAALADPPTAD------TRLQVSGW---GFQAEESAVSGEVGVSPQLRFVDVDLVESNQC 185
             :.|.:|:|   |..|      |:....||   |.||....|..|:.|:          |.:..|
Mouse   133 GKEVAVASL---PQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVT----------VVTFLC 184

  Fly   186 RRAYSQVLPITRRMICAARPGRDS--CQGDSGGPLVGYAAEEGPARLYGIVSWGL-GCANPNFPG 247
            |          ...:|...|.|.:  |.|||||||:....      |:|:.|:.: .||:..||.
Mouse   185 R----------EHNVCTLVPRRAAGICFGDSGGPLICNGI------LHGVDSFVIRECASLQFPD 233

  Fly   248 VYTNVAAFRSWIDEQLDARG 267
            .:..|:.:..||...|  ||
Mouse   234 FFARVSMYVDWIQNVL--RG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 81/253 (32%)
Tryp_SPc 28..262 CDD:238113 83/255 (33%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 81/253 (32%)
Tryp_SPc 30..248 CDD:238113 83/255 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.