DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and try-1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:254 Identity:96/254 - (37%)
Similarity:140/254 - (55%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQLQ-GRHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEH 88
            |.|::||..::...:|:.|.:..: |.|.|||::|..:.||||||||........|:||||.  |
 Worm    55 DHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGG--H 117

  Fly    89 ESGGHVLSLRRVIA---HGDYN---PQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTR 147
            .||..  |..||.|   |..||   |.|:  |.|::.::..:|.:...:|:.|.:|   |..:.|
 Worm   118 RSGSG--SPHRVTAVSIHPWYNIGFPSSY--DFAIMRIHPPVNTSTTARPICLPSL---PAVENR 175

  Fly   148 L-QVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQV----LPITRRMICAARP-G 206
            | .|:|||...|.|::|     :|.||.:.|.|:.:..|....:.:    ||   .|:||... |
 Worm   176 LCVVTGWGSTIEGSSLS-----APTLREIHVPLLSTLFCSSLPNYIGRIHLP---SMLCAGYSYG 232

  Fly   207 R-DSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLD 264
            : |||||||||||:  .|.:|...|.|:||||:|||.|..||||.||.:..:||:.:::
 Worm   233 KIDSCQGDSGGPLM--CARDGHWELTGVVSWGIGCARPGMPGVYGNVHSASTWINLEMN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 93/245 (38%)
Tryp_SPc 28..262 CDD:238113 94/247 (38%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 93/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.