DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Tpsb2

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:274 Identity:102/274 - (37%)
Similarity:137/274 - (50%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATPTPGDGR--IVGGEVATIQEFPYQVSVQLQGR---HICGGAIIGIDTVLTA 66
            ||.|..|.:...:.|.|.:.|  ||||..|:..::|:|||::.:..   |.|||::|....||||
Mouse     9 LWALSLLASLVYSAPRPANQRVGIVGGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTA 73

  Fly    67 AHCFEDPWSSADYTVRVGSSEH--ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEH 129
            |||. .|...:....||...|.  ..|..:|||.|::.|..|.......|:|||.|...:|.:.|
Mouse    74 AHCV-GPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTH 137

  Fly   130 LQPVPLAALADPPTAD-----TRLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCRR 187
            |.|:.|     ||.::     |...|:|||      .:..:..:.|  .|:.|.|.:||::.|.|
Mouse   138 LHPISL-----PPASETFPPGTSCWVTGWG------DIDNDEPLPPPYPLKQVKVPIVENSLCDR 191

  Fly   188 AYSQVL------PITR-RMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNF 245
            .|...|      ||.. .|:||....|||||||||||||  ...:|.....|:||||.|||.||.
Mouse   192 KYHTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLV--CKVKGTWLQAGVVSWGEGCAQPNK 254

  Fly   246 PGVYTNVAAFRSWI 259
            ||:||.|..:..||
Mouse   255 PGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 94/252 (37%)
Tryp_SPc 28..262 CDD:238113 95/251 (38%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 95/251 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.