DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS36

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:261 Identity:93/261 - (35%)
Similarity:132/261 - (50%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFE-----DPWSSADYT 80
            |.| ..|||||..|....:|:|||:...|.|||||::|....||:|||||.     :|  :|:::
Human    41 PEP-SARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNGTLEP--AAEWS 102

  Fly    81 VRVGSSEHE---SGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPP 142
            |.:|....:   .|.|..::..::...:|:......|||||.|....:....:.||.|...:...
Human   103 VLLGVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRF 167

  Fly   143 TADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQ------VLPITRRMIC 201
            ...|....:|||...|    :..:.:...|:.|::.|:....|:..|||      .|.|...|:|
Human   168 VHGTACWATGWGDVQE----ADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLC 228

  Fly   202 AARP--GRDSCQGDSGGPLVGYAAEEGPARLY--GIVSWGLGCANPNFPGVYTNVAAFRSWIDEQ 262
            |..|  .||:||||||||||   .||| .|.:  ||.|:|.||...|.|||:|.||.:.:||.||
Human   229 AGYPEGRRDTCQGDSGGPLV---CEEG-GRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWIREQ 289

  Fly   263 L 263
            :
Human   290 V 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 87/249 (35%)
Tryp_SPc 28..262 CDD:238113 88/251 (35%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 87/249 (35%)
Tryp_SPc 47..289 CDD:238113 88/251 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149419
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.