DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss29

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:281 Identity:103/281 - (36%)
Similarity:146/281 - (51%) Gaps:38/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LWWLMALVAYAGATPTPG-DG---RIVGGEVATIQEFPYQVSVQLQGR------HICGGAIIGID 61
            |::|...:|   .||.|| :|   .||||..|...::|:|||:::...      |.|||:||...
Mouse     9 LFFLGCSIA---GTPAPGPEGVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQ 70

  Fly    62 TVLTAAHCFEDPWSSAD---YTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQ 123
            .|||||||..:  ..||   :.:|||.:....|..:||:.|||.|.|:......:|:|||.|...
Mouse    71 WVLTAAHCIRE--RDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVS 133

  Fly   124 LNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCR 186
            :....:::||.|.:.:...|......|:|||      |||....:.|  :|:.|.|.:::::.|.
Mouse   134 VQSFPNVKPVKLPSESLEVTKKDVCWVTGWG------AVSTHRSLPPPYRLQQVQVKIIDNSLCE 192

  Fly   187 RAY---------SQVLPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCAN 242
            ..|         .|.| |.:.|:||...|:|||.||||||||  ....|...|.|:||||.|||.
Mouse   193 EMYHNATRHRNRGQKL-ILKDMLCAGNQGQDSCYGDSGGPLV--CNVTGSWTLVGVVSWGYGCAL 254

  Fly   243 PNFPGVYTNVAAFRSWIDEQL 263
            .:|||||..|.:|..||.:|:
Mouse   255 RDFPGVYARVQSFLPWITQQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 92/251 (37%)
Tryp_SPc 28..262 CDD:238113 94/253 (37%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 94/253 (37%)
Tryp_SPc 31..271 CDD:214473 92/250 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.