DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss28

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:282 Identity:94/282 - (33%)
Similarity:141/282 - (50%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STKFLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGR------HICGGAIIGID 61
            ||.|    ||.|:.:.:.|.    .||||:.....::|:|||:::...      |||||:||...
Mouse    14 STVF----MASVSISRSKPV----GIVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIHPQ 70

  Fly    62 TVLTAAHCFE----DPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNG 122
            .:||||||.:    ||   |.|.|:||.........:|::.|:|.|.|||..|...||||:.|..
Mouse    71 WILTAAHCIQSQDADP---AVYRVQVGEVYLYKEQELLNISRIIIHPDYNDVSKRFDLALMQLTA 132

  Fly   123 QLNFTEHLQPVPLAALADPPTADTRLQ--VSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESN 183
            .|..:.::.||.|.  .|..|.|:..|  :.|||...:      .|.:.|  ||..|.:.:.::.
Mouse   133 LLVTSTNVSPVSLP--KDSSTFDSTDQCWLVGWGNLLQ------RVPLQPPYQLHEVKIPIQDNK 189

  Fly   184 QCRRAY-------SQVLPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCA 241
            .|:|||       .:.:.|...|:||...||..|.||||||||.:.:.:...  .|:||.|:.|:
Mouse   190 SCKRAYRKKSSDEHKAVAIFDDMLCAGTSGRGPCFGDSGGPLVCWKSNKWIQ--VGVVSKGIDCS 252

  Fly   242 NPNFPGVYTNVAAFRSWIDEQL 263
            | |.|.:::.|.:..:||.:.:
Mouse   253 N-NLPSIFSRVQSSLAWIHQHI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 85/252 (34%)
Tryp_SPc 28..262 CDD:238113 87/254 (34%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 87/254 (34%)
Tryp_SPc 31..269 CDD:214473 85/251 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.