DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and PRSS21

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:312 Identity:100/312 - (32%)
Similarity:143/312 - (45%) Gaps:63/312 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAG--------ATPTPG-------DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIG 59
            |..|:|.||        |.|..|       ..||||||.|.:..:|:|.|::|...|:||.:::.
Human     9 LALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLS 73

  Fly    60 IDTVLTAAHCFE------DP----------------WSSADYTVRVGSSEHESGGHVLSLRRVIA 102
            ....||||||||      ||                ||...|..|...|      ::....|.:.
Human    74 HRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVS------NIYLSPRYLG 132

  Fly   103 HGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVG 167
            :..|       |:||:.|:..:.:|:|:||:.|.|........|...|:|||:..|:.|:.    
Human   133 NSPY-------DIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALP---- 186

  Fly   168 VSPQ-LRFVDVDLVESNQCRR---AYSQVLPITRRMICA--ARPGRDSCQGDSGGPLVGYAAEEG 226
             ||. |:.|.|.::.::.|..   .||....|...|:||  |:.|:|:|.|||||||.  ..:.|
Human   187 -SPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLA--CNKNG 248

  Fly   227 PARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQLDARGWDELLAGWSRL 278
            .....|:||||:||..||.||||||::....||.:.:...|..:....|..|
Human   249 LWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 87/259 (34%)
Tryp_SPc 28..262 CDD:238113 88/261 (34%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 88/260 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.