DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Try5

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001003405.1 Gene:Try5 / 103964 MGIID:102756 Length:246 Species:Mus musculus


Alignment Length:272 Identity:96/272 - (35%)
Similarity:134/272 - (49%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYSTKFLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLT 65
            |.|..||    |||..|.|.|...|.:||||........|||||:. .|.|.|||::|....|::
Mouse     1 MNSLLFL----ALVGAAVAFPVDDDDKIVGGYTCRENSIPYQVSLN-SGYHFCGGSLINDQWVVS 60

  Fly    66 AAHCFEDPWSSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLN 125
            ||||::     ....||:|  ||     |.....::..::|.|.::|.::.:||:.|:.|...:.
Mouse    61 AAHCYK-----TRIQVRLG--EHNINVLEGNEQFVNSAKIIKHPNFNSRTLNNDIMLIKLASPVT 118

  Fly   126 FTEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYS 190
            ....:..|.|.:...|  |.|:..:||||     :.:|..|.....|:.:|..|:....|..:|.
Mouse   119 LNARVATVALPSSCAP--AGTQCLISGWG-----NTLSFGVNNPDLLQCLDAPLLPQADCEASYP 176

  Fly   191 QVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVA 253
            .  .||..|||..  ..|:||||||||||:|      ...:|.||||||.|||..:.|||||.|.
Mouse   177 G--KITNNMICVGFLEGGKDSCQGDSGGPVV------CNGQLQGIVSWGYGCALKDNPGVYTKVC 233

  Fly   254 AFRSWIDEQLDA 265
            .:..||.:.:.|
Mouse   234 NYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 82/238 (34%)
Tryp_SPc 28..262 CDD:238113 84/240 (35%)
Try5NP_001003405.1 Tryp_SPc 23..239 CDD:214473 82/238 (34%)
Tryp_SPc 24..242 CDD:238113 84/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.