DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and LOC102554637

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:261 Identity:90/261 - (34%)
Similarity:133/261 - (50%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74
            ::.||..|.|.|...|.:||||........|||||:. .|.|.|||::|....|::||||::   
  Rat     6 VLVLVGAAVAFPVDDDDKIVGGYTCQEHSVPYQVSLN-SGYHYCGGSLINDQWVVSAAHCYK--- 66

  Fly    75 SSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVP 134
              :...||:|  ||     |.....::..::|.|.:::.::.:||:.|:.|:..:.....:..|.
  Rat    67 --SRIQVRLG--EHNINVLEGDEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVA 127

  Fly   135 LAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRM 199
            |.:...|  |.|:..:||||     :.:|..|.....|:.:|..|:....|..:|..  .||..|
  Rat   128 LPSSCAP--AGTQCLISGWG-----NTLSFGVNDPDLLQCLDAPLLPQADCEASYPG--KITNNM 183

  Fly   200 ICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDEQ 262
            :||.  ..|:||||||||||:|      ....|.||||||.|||.|:.|||||.|..:..||.:.
  Rat   184 VCAGFLEGGKDSCQGDSGGPVV------CNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDT 242

  Fly   263 L 263
            :
  Rat   243 I 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 82/238 (34%)
Tryp_SPc 28..262 CDD:238113 84/240 (35%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 84/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.