DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and LOC101730924

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:265 Identity:94/265 - (35%)
Similarity:127/265 - (47%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFEDPW 74
            |:.|....||.....|.:|:||........||.||:. .|.|.|||::|....|::||||::   
 Frog     3 LLLLCVLLGAAAAFDDDKIIGGATCAKNSVPYIVSLN-SGYHFCGGSLINNQWVVSAAHCYK--- 63

  Fly    75 SSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALLILN--GQLNFTEHLQP 132
              |...||:|  ||     |.....:|..:||.|..||..:.|||:.|:.|:  ..||...:...
 Frog    64 --ASIQVRLG--EHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNAAVNAVA 124

  Fly   133 VPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITR 197
            :|....|    |.|...:||||     :.:|........|:.:...::...||..||..  .||.
 Frog   125 LPSGCAA----AGTSCLISGWG-----NTLSSGSNYPDLLQCLYAPILTDAQCNNAYPG--EITN 178

  Fly   198 RMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWID 260
            .|||..  ..|:||||||||||:|      ...:|.|:||||.|||..|:|||||.|..:.|||.
 Frog   179 NMICLGFLEGGKDSCQGDSGGPVV------CNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQ 237

  Fly   261 EQLDA 265
            ..:.|
 Frog   238 STIAA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 86/240 (36%)
Tryp_SPc 28..262 CDD:238113 88/242 (36%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 88/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.