DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and zgc:163079

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:246 Identity:78/246 - (31%)
Similarity:131/246 - (53%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PGDGRIVGGEVATIQEFPYQVSVQLQG--RHICGGAIIGIDTVLTAAHCFEDPWSSADYTVRVG- 84
            |.:.:|:||..||...:|:|.|:.|:.  ...|||::|....|||.|..|. ...::|..|.:| 
Zfish    31 PLNTKIIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFA-LMPASDIVVYLGR 94

  Fly    85 SSEHESGGHVLS--LRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTR 147
            .:::.|..:.:|  :.::|.|.:||  |.|::||||.|:..:.|:::::||.|||........|.
Zfish    95 QTQNGSNPYEISRTVTKIIKHPNYN--SLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDGTA 157

  Fly   148 LQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRMICAA---RPGRDS 209
            ..|:|||:....:.|. |:.:...|:.|:..:|.:.:|..||..:  ||.:::||.   ..|:..
Zfish   158 SWVTGWGYLNRPATVE-EIMLPDVLQEVEAPIVNNFECNAAYGGI--ITNKLLCAGYLNEDGKAP 219

  Fly   210 CQGDSGGPLVGYAAEEGPARLY-GIVSWGLGCANPNFPGVYTNVAAFRSWI 259
            |.||.|||||   .::|...:. |:|..|. |..|.:|.:|..|:.:..||
Zfish   220 CAGDVGGPLV---IKQGAIWIQSGVVVSGY-CGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 75/240 (31%)
Tryp_SPc 28..262 CDD:238113 77/241 (32%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 75/240 (31%)
Tryp_SPc 36..267 CDD:238113 77/241 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.