DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED8 and Med8

DIOPT Version :9

Sequence 1:NP_722456.1 Gene:MED8 / 37305 FlyBaseID:FBgn0034503 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006503554.1 Gene:Med8 / 80509 MGIID:1915269 Length:284 Species:Mus musculus


Alignment Length:291 Identity:120/291 - (41%)
Similarity:167/291 - (57%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETI----------------NWPTFLDNF 49
            |||:||..|.:||.:|.::.|||.::.|.|.|||.||:.:                :.|:.||:|
Mouse     1 MQREEKQLEASLDALLNQVADLKNSLGSFIYKLENEYDRLTCKSGSCLCQTQGCESSGPSVLDSF 65

  Fly    50 AIISSHLTGLTKILAKEQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPD 114
            |::|..|..|.|:|..|:.|..||:.::||::|.|||:.|:..||||||||||::|||:|||:||
Mouse    66 ALLSGQLNTLNKVLKHEKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPD 130

  Fly   115 PITEQKMLQNEQKAANLTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMAD 179
            |..|::..|....||.:..|||.||:...||:.|::|:.:||  ||.|.||......:||.:..|
Mouse   131 PEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNLLEKISK--EERESESGGLRPNKQTFNPGD 193

  Fly   180 TQLLVAAVGMGKGLKLTNYGP----GPGMMVPPSIRAPSPMGGPA-----MSPG--NVQQ----- 228
            |..|||||..|||  |:|:.|    |||....|.  |.:.:.|.:     ..||  |.||     
Mouse   194 TNALVAAVAFGKG--LSNWRPSGSSGPGQPGQPG--AGTILAGASGLPQVQMPGAPNQQQPMLSG 254

  Fly   229 -------QLGKAPSAVKTNIKSANQVHPFSR 252
                   |.||.||.:|||||||: :||:.|
Mouse   255 VQMAQAGQPGKMPSGIKTNIKSAS-MHPYQR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED8NP_722456.1 Med8 1..249 CDD:287234 117/286 (41%)
Med8XP_006503554.1 Med8 1..281 CDD:370903 117/286 (41%)
Med15 <212..>269 CDD:312941 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834661
Domainoid 1 1.000 193 1.000 Domainoid score I3196
eggNOG 1 0.900 - - E1_KOG3583
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10560
Inparanoid 1 1.050 196 1.000 Inparanoid score I3810
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48625
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008222
OrthoInspector 1 1.000 - - oto94318
orthoMCL 1 0.900 - - OOG6_107763
Panther 1 1.100 - - LDO PTHR13074
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2639
SonicParanoid 1 1.000 - - X7257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.