DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED8 and med8

DIOPT Version :9

Sequence 1:NP_722456.1 Gene:MED8 / 37305 FlyBaseID:FBgn0034503 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001016614.1 Gene:med8 / 549368 XenbaseID:XB-GENE-963498 Length:267 Species:Xenopus tropicalis


Alignment Length:275 Identity:122/275 - (44%)
Similarity:173/275 - (62%) Gaps:31/275 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFAIISSHLTGLTKILAK 65
            |||:||..|..||.::.:::|:|.:::..|.|||.||:.:.||:.||:||::|..|..|.|:|..
 Frog     1 MQREEKQLEACLDALISQVSDIKNSLVGFIHKLENEYDRLTWPSVLDSFALLSGQLNTLNKVLKN 65

  Fly    66 EQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMLQNEQKAAN 130
            |:.|.|||:.::|||:|.|||:.::.:||||||||||::|||:|||:|||..|:...|...:||.
 Frog    66 EKTPLLRNQVIIPLLLSPDRDEEIMRLTEGRVPVFSHEVVPDHLRTKPDPDVEELEKQLSAEAAR 130

  Fly   131 LTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKL 195
            :|::||.|||...||:.|::||.:||  ||.|.|..|....:||.:..||..|||||..|||  |
 Frog   131 ITSEAAQKQVQSMNKMCSNLLDKISK--EERESELGSLRQNKQTFNPTDTNALVAAVAFGKG--L 191

  Fly   196 TNYGP----GP----------------GMMVPPSI---RAPSPMGGPAMSPGNVQQQLGKAPSAV 237
            :|..|    ||                ||.||.|:   :....|.|.:||.|:   |.||.||::
 Frog   192 SNRRPPGQGGPMAPGQTGASSMLPNATGMQVPMSLPPNQQQQHMAGVSMSQGS---QPGKMPSSI 253

  Fly   238 KTNIKSANQVHPFSR 252
            |||||||: :||:.|
 Frog   254 KTNIKSAS-MHPYQR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED8NP_722456.1 Med8 1..249 CDD:287234 119/270 (44%)
med8NP_001016614.1 Med8 1..264 CDD:370903 119/270 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..267 30/82 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2866
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10560
Inparanoid 1 1.050 208 1.000 Inparanoid score I3600
OMA 1 1.010 - - QHG48625
OrthoDB 1 1.010 - - D1392867at2759
OrthoFinder 1 1.000 - - FOG0008222
OrthoInspector 1 1.000 - - oto104529
Panther 1 1.100 - - LDO PTHR13074
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2639
SonicParanoid 1 1.000 - - X7257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.