DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED8 and med8

DIOPT Version :9

Sequence 1:NP_722456.1 Gene:MED8 / 37305 FlyBaseID:FBgn0034503 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_996966.1 Gene:med8 / 404615 ZFINID:ZDB-GENE-040426-2091 Length:267 Species:Danio rerio


Alignment Length:275 Identity:108/275 - (39%)
Similarity:159/275 - (57%) Gaps:34/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFAIISSHLTGLTKILAKE 66
            ||:||..|..|::::.|:..||.::.|.|.|||.||:.:.||:.|||||:||..|..:.|:|..|
Zfish     3 QREEKQLEAFLESLVARVAHLKGSLQSFIYKLENEYDRLTWPSVLDNFALISGQLNTINKLLRNE 67

  Fly    67 QCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMLQNEQKAANL 131
            :.|..:::.::|||:|.|||:.|..:||.|||||||:||||:|||:|||..|::......:||.:
Zfish    68 KTPSYKSQVIIPLLLSPDRDEELAKLTEHRVPVFSHEIVPDHLRTKPDPEVEEQEKHLSAEAARI 132

  Fly   132 TNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLT 196
            ..:.|.||:...||:.|::|:.::..||:.:.|:|:....:.:.:.|||..||||||.||||...
Zfish   133 GPEVAQKQIQALNKLCSNLLEKLNNPREDRDSETSALRQNKPSFNPADTNALVAAVGFGKGLSKC 197

  Fly   197 NYGPGPGMMVPPSIRAPSPMGGPAMSPGNVQQQL------------------------GKAPSAV 237
            .         ||...||...|.|.|..|...||:                        ||.||.:
Zfish   198 R---------PPGPVAPGHPGQPMMQTGPTLQQVTIAGASGHQAGMSGPVAPQQPGQPGKIPSNI 253

  Fly   238 KTNIKSANQVHPFSR 252
            |||||||: :||::|
Zfish   254 KTNIKSAS-MHPYNR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED8NP_722456.1 Med8 1..249 CDD:287234 105/270 (39%)
med8NP_996966.1 Med8 3..264 CDD:287234 105/270 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..180 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..267 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577667
Domainoid 1 1.000 183 1.000 Domainoid score I3386
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10560
Inparanoid 1 1.050 186 1.000 Inparanoid score I3916
OMA 1 1.010 - - QHG48625
OrthoDB 1 1.010 - - D1392867at2759
OrthoFinder 1 1.000 - - FOG0008222
OrthoInspector 1 1.000 - - oto40692
orthoMCL 1 0.900 - - OOG6_107763
Panther 1 1.100 - - LDO PTHR13074
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.