DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED8 and MED8

DIOPT Version :9

Sequence 1:NP_722456.1 Gene:MED8 / 37305 FlyBaseID:FBgn0034503 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_443109.2 Gene:MED8 / 112950 HGNCID:19971 Length:301 Species:Homo sapiens


Alignment Length:274 Identity:120/274 - (43%)
Similarity:164/274 - (59%) Gaps:28/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFAIISSHLTGLTKILAK 65
            |||:||..|.:||.:|.::.|||.::.|.|.|||.||..:.||:.||:||::|..|..|.|:|..
Human     1 MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKH 65

  Fly    66 EQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMLQNEQKAAN 130
            |:.|..||:.::||::|.|||:.|:..||||||||||::|||:|||:|||..|::..|....||.
Human    66 EKTPLFRNQVIIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAAR 130

  Fly   131 LTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKL 195
            :..|||.||:...||:.|::|:.:||  ||.|.||......:||.:..||..|||||..|||  |
Human   131 IGADAAQKQIQSLNKMCSNLLEKISK--EERESESGGLRPNKQTFNPTDTNALVAAVAFGKG--L 191

  Fly   196 TNYGP----GPGMMVPPS----------------IRAPSPMGGPAMSPGNVQQ--QLGKAPSAVK 238
            :|:.|    |||....|.                ..|||.. .|.:|...:.|  |.||.||.:|
Human   192 SNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQMAGAPSQQ-QPMLSGVQMAQAGQPGKMPSGIK 255

  Fly   239 TNIKSANQVHPFSR 252
            ||||||: :||:.|
Human   256 TNIKSAS-MHPYQR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED8NP_722456.1 Med8 1..249 CDD:287234 117/269 (43%)
MED8NP_443109.2 Med8 1..265 CDD:287234 120/274 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144538
Domainoid 1 1.000 190 1.000 Domainoid score I3285
eggNOG 1 0.900 - - E1_KOG3583
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10560
Inparanoid 1 1.050 192 1.000 Inparanoid score I3864
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48625
OrthoDB 1 1.010 - - D1392867at2759
OrthoFinder 1 1.000 - - FOG0008222
OrthoInspector 1 1.000 - - oto90733
orthoMCL 1 0.900 - - OOG6_107763
Panther 1 1.100 - - LDO PTHR13074
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2639
SonicParanoid 1 1.000 - - X7257
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.