DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tapas and tdrkh

DIOPT Version :9

Sequence 1:NP_611475.3 Gene:tapas / 37304 FlyBaseID:FBgn0027529 Length:1222 Species:Drosophila melanogaster
Sequence 2:XP_017213943.1 Gene:tdrkh / 541541 ZFINID:ZDB-GENE-050327-81 Length:885 Species:Danio rerio


Alignment Length:334 Identity:69/334 - (20%)
Similarity:125/334 - (37%) Gaps:92/334 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   950 GLRLELEMASSIHPEKYDHTLLSSNVQLPRRGSFSSVFSNQSSSSDLVATTPPVT--PEK---KP 1009
            |.|.|::.|..:..||     :..|..:.:|.|.:|....:..        ||.|  ||.   ||
Zfish   207 GTRKEIQSAKEMIMEK-----VIENETVRKRISQASALRQRRK--------PPETQGPENELLKP 258

  Fly  1010 SAR----------------------STGSTFSSLMLKDYEAIPAVG------------------- 1033
            :.:                      ||.:..:||..:|.|.:..|.                   
Zfish   259 NGKDLPTLVNELKQELPVTVNGYVDSTDTAENSLRSEDEEILSPVSPLEISKFEIPSPDLSFQPD 323

  Fly  1034 AYFEVRVALSVNPGHFAVQ---------------PYKYYNQLQTLMKNLQEHCQKTAAKGVQPSQ 1083
            .:.||.|:.|.||.||.:|               ..::||.     .:.|||..:|         
Zfish   324 EHLEVYVSASENPQHFWIQILGVRSLQLDKLTAEMSRFYNG-----DSSQEHRVET--------- 374

  Fly  1084 LAIGEAYAAP-DSEGVYHRVSIHKIYDE-IIHVRFVDVGDDGVIACDQLKTLNPELRKLPKMALP 1146
            :.:|:..||| ...|.::|..:..|... ::.:.:||.||:|.:..:.|:::..:...||..|:.
Zfish   375 IIVGDIVAAPYRDHGTWNRARVLGIVGSGLVDLYYVDFGDNGELPREHLRSMRSDFLSLPFQAIE 439

  Fly  1147 AQLYGIQLTDVVWSKENCVRFRELSLGQKFIGIVRRMTKQKDGGRAL--CLELVDTSTPKDIKLH 1209
            ..|.|::....||::.....|..::...::..::.::........:.  .::|.|.|..|.:.|.
Zfish   440 CSLAGVRPEGEVWTEAALDDFERMTFCAEWKPLLAKLYSYSHSEISSWPSVKLYDNSQGKAVDLG 504

  Fly  1210 EILINEKHA 1218
            :.||...||
Zfish   505 KELIRLGHA 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapasNP_611475.3 LOTUS_TDRD_OSKAR 7..92 CDD:193586
TUDOR 563..673 CDD:278965
TUDOR 766..896 CDD:278965
TUDOR 1032..1151 CDD:278965 33/154 (21%)
TUDOR 1087..1131 CDD:119391 12/45 (27%)
tdrkhXP_017213943.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.