DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tapas and papi

DIOPT Version :9

Sequence 1:NP_611475.3 Gene:tapas / 37304 FlyBaseID:FBgn0027529 Length:1222 Species:Drosophila melanogaster
Sequence 2:NP_608657.1 Gene:papi / 33401 FlyBaseID:FBgn0031401 Length:576 Species:Drosophila melanogaster


Alignment Length:485 Identity:99/485 - (20%)
Similarity:173/485 - (35%) Gaps:144/485 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   837 WFRGRLVTRPLNPDEESFDVYYVDDGRQRKA-------------------------HI------- 869
            :|:.|      |.:||:      |.|.||.|                         |:       
  Fly    32 YFKTR------NDEEEA------DSGGQRPASGIRGQTEEQKPQKEVCLKIVVDNEHVPLIMGRG 84

  Fly   870 -SNIYRLEANNRALATFPPQAIPVRLHDVPEIGGHMLHRLRGLIPWRTEA----LLKVVAMDGGK 929
             |||..:|....|         .:||.|  :..||....:.| :|...:|    |:|.:..   .
  Fly    85 GSNIKLIEEKTLA---------KIRLRD--KDSGHKFCDISG-VPDAVKAARALLIKEIER---A 134

  Fly   930 PLVNVFIREDPESMYMCVN-IGLRLELEMASSIHPEKYDHTLLSSNVQLPRRGSFS--SVFSNQ- 990
            |:|.|.: :.|:.:...:| .|..|..|:.||        :|...|:.|..|...:  ::..|| 
  Fly   135 PVVKVEL-QVPQRLASKINGRGGELLQEIRSS--------SLAKLNIDLNGRNGKAKITIIGNQK 190

  Fly   991 -------------SSSSDLVATTPPVTPEKKPSARSTGSTFSSLMLKDYEAIPAVGAYFEVRVAL 1042
                         ....:||.:...|...::|....|.|..||:    |.:..::.::.:.|..|
  Fly   191 QVNIARKMLDDQIEEDEELVRSMEEVEQRREPRRSPTNSIASSM----YSSQTSLSSHTQPRDKL 251

  Fly  1043 SVNPGH---------FAVQPYKYYNQL-----QTLMKNLQE-----HCQKTAAKGVQPSQLAIGE 1088
            ..:.|.         ....|.|::.||     :.|...:||     ...:..||.|..:.. :|:
  Fly   252 MASKGEGKPMEVYVSAVASPTKFWVQLIGPQSKKLDSMVQEMTSYYSSAENRAKHVLTAPY-VGQ 315

  Fly  1089 AYAAP---DSEGVYHRVSIHKIY-------DEIIHVRFVDVGDDGVIACDQLKTLNPELRKLPKM 1143
            ..||.   |.:  ::|..|..|.       :::|.:.|||.||...|:...:..|..:...|...
  Fly   316 IVAAVFKFDEK--WYRAEIVDIMPNQYNPKEQVIDLYFVDYGDSEYISPADICELRTDFLTLRFQ 378

  Fly  1144 ALPAQLYG----IQLTDVVWSKENCVRFRELSLGQKFIGIVRRMTKQKDGGRALC---------- 1194
            |:...|..    ||...:.|.|.:..:|.||:....:..::.|:...|:..||..          
  Fly   379 AVECFLANVKSTIQTEPITWPKSSIAKFEELTEVAHWRKLIARVVTYKERPRATTAVSAAAKEGT 443

  Fly  1195 ----LELVDTSTPKDIKLHEILINEKHAQP 1220
                :||.|.:...::.:.:::|.:..|.|
  Fly   444 PLPGVELFDPADNSELNIADLMITQGFALP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tapasNP_611475.3 LOTUS_TDRD_OSKAR 7..92 CDD:193586
TUDOR 563..673 CDD:278965
TUDOR 766..896 CDD:278965 18/91 (20%)
TUDOR 1032..1151 CDD:278965 31/147 (21%)
TUDOR 1087..1131 CDD:119391 14/53 (26%)
papiNP_608657.1 KH-I 68..127 CDD:238053 14/70 (20%)
KH_1 138..201 CDD:306517 14/71 (20%)
TUDOR 257..386 CDD:306940 28/131 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.