DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and PBR1

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_014218.2 Gene:PBR1 / 855540 SGDID:S000005125 Length:407 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:64/284 - (22%)
Similarity:124/284 - (43%) Gaps:47/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGG-NRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDL-NATKGKLI-CEQLDVG 129
            ::.::||. ::|:|..:..|:......:::..|:  :.|.......:| ..||.:|| .|:.|:.
Yeast    54 KVYLVTGATSQGMGTSVAYKMAELGAQLIILTRE--VDEWVTEWCEELREKTKNELIFVEKCDLS 116

  Fly   130 DLKSVKAFAQ--LIKERYSKVDLLLNNAGIMFAPF----------KLTADGYESHFAINFLGHFL 182
            :|..::.||.  |......::|.::..:|.| .|:          :.:.||.|...|.|::..|.
Yeast   117 NLWEIRKFATSWLDNSPPRRLDGVIVMSGDM-EPWGIPKISLPQRRSSKDGLELQIATNYVAIFH 180

  Fly   183 LTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKD--INGTKHYYPGTAYSQSKLAQILFTR 245
            |.:||.|..:|...: |:.||:..:..:.::|.||.:|  ....|:......::.|||...|...
Yeast   181 LLNLLQPSFKAQPPD-RDVRIILATCWLQVVGDINIEDPLWQNAKYKSALKFFASSKLQLGLSMM 244

  Fly   246 HLQTLL----------DAEKS--HVQVNVVHPGIVDTDLFEHSATTS-------------VPIFK 285
            .||..|          .||::  :|.:.:|.||.:.::......:..             .||. 
Yeast   245 ELQRRLTEDIKNQKTNGAERTGKNVTITMVQPGTMRSNSLRRVISNGSVVLLIILYCILLYPIL- 308

  Fly   286 KLFFKTPERGSRTVVFAAIDPSIE 309
            .||.|:..||.::.::|.:.|.:|
Yeast   309 WLFTKSGRRGDQSFLYALMTPELE 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 64/284 (23%)
NADB_Rossmann 67..338 CDD:304358 64/284 (23%)
PBR1NP_014218.2 retinol-DH_like_SDR_c_like 53..367 CDD:212492 64/284 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.