DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and AT5G53100

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_200122.1 Gene:AT5G53100 / 835390 AraportID:AT5G53100 Length:364 Species:Arabidopsis thaliana


Alignment Length:295 Identity:90/295 - (30%)
Similarity:138/295 - (46%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGK-----LICEQLDVGD 130
            ::||...|||.....:|......|||.||:.|.|...:.......:..|:     :...:||:..
plant    48 IVTGSTSGIGSETARQLAEAGAHVVMAVRNIKAAHELIQQWQTKWSASGEGLPLNIQAMELDLLS 112

  Fly   131 LKSVKAFAQLIKERYSKVDLLLNNAGIMFA---PFKLTADGYESHFAINFLGHFLLTHLLLPQLR 192
            |.||..|:.....|.:.:.:|:|||| |||   ..|.:.||||.|..:|.|...||:.||||.|.
plant   113 LDSVVRFSNAWNARLAPLHVLINNAG-MFAMGGAQKFSEDGYEQHMQVNHLAPALLSLLLLPSLI 176

  Fly   193 AAGKEGRNSRIVNVSSCVNLIGRINYKDIN---GTKHYYPGTAYSQSKLAQILFTRHLQTLLDAE 254
            .|.:    |||:||:|.::.:|.::..|:|   |.:.:...:|||.|||||::|...|...|..|
plant   177 RASR----SRIINVNSVMHYVGFVDPNDMNFVSGKRKFSSLSAYSSSKLAQVMFNNVLLKKLPLE 237

  Fly   255 KSHVQVNVVHPGIVDTDLFEHSATTSVP-----IFKKL--FFKTPERGSRTVVFAAIDPSIEGQG 312
             :.:.|..:.||:|.|::     |..:|     ::..|  |..:|:.|.|:.:|:|.||.|    
plant   238 -TGISVVCLSPGVVQTNI-----TRDLPRLVQDLYSALPYFIFSPQEGCRSSLFSATDPQI---- 292

  Fly   313 GTYLSNGGKGPFHPDAKK---PAKCEQLFQFSCDL 344
                      |.|....|   .:.|......:|.|
plant   293 ----------PNHYQKLKTNEKSVCTLFISLNCKL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 89/293 (30%)
NADB_Rossmann 67..338 CDD:304358 88/287 (31%)
AT5G53100NP_200122.1 PRK06197 46..342 CDD:235737 90/295 (31%)
NADB_Rossmann 48..334 CDD:304358 90/295 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.