DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and AT5G50130

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_568721.1 Gene:AT5G50130 / 835078 AraportID:AT5G50130 Length:339 Species:Arabidopsis thaliana


Alignment Length:265 Identity:86/265 - (32%)
Similarity:131/265 - (49%) Gaps:25/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKSV 134
            |:||||..|||......|....:.|||.|||.|.||.....|:..| .:..:|..::|:..|.||
plant    39 AIITGGTSGIGAETARVLAKRGVRVVMAVRDMKKAEMVKERIIREN-PEADIILFEIDLSSLSSV 102

  Fly   135 KAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQ-LRAAGKEG 198
            ..|......:...:::|:||||:.....:.:.:..|..||.|||||:|||.:|:.: :..|.|.|
plant   103 ARFCSQFLSQDLPLNILINNAGVFSPNLEFSEEKIELTFATNFLGHYLLTEMLIEKMIDTAEKSG 167

  Fly   199 RNSRIVNVSSCVN------------LIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLL 251
            ...||:|:||.::            |:..|:  ..|||:      ||:|||||.||..:.|...|
plant   168 IEGRIINLSSVIHNWVKPDCFSFPKLLHPIS--RYNGTR------AYAQSKLATILHAKALSKQL 224

  Fly   252 DAEKSHVQVNVVHPGIVDTDLFE-HSA--TTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGG 313
            ....::|.:|.||||||.|.:.. |..  |.|:.:......|:..:|:.|..:.|:....:|..|
plant   225 KDRNANVTINAVHPGIVKTGIIRAHKGLFTDSLFLIASKLLKSISQGAATTCYVALSNETKGLSG 289

  Fly   314 TYLSN 318
            .|.::
plant   290 KYFAD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 86/265 (32%)
NADB_Rossmann 67..338 CDD:304358 86/265 (32%)
AT5G50130NP_568721.1 retinol-DH_like_SDR_c_like 38..313 CDD:212492 86/265 (32%)
adh_short 38..245 CDD:278532 76/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.