DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and AT5G04070

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_196027.3 Gene:AT5G04070 / 830286 AraportID:AT5G04070 Length:359 Species:Arabidopsis thaliana


Alignment Length:308 Identity:86/308 - (27%)
Similarity:140/308 - (45%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKS 133
            :.||||...|:|......|......||:..|...:....::.|...| ...||...::|:...:.
plant    60 VCVITGATSGLGKATAFALSRKGFYVVLVGRSSHLLSKTLSDIKRQN-EDAKLKAFEVDMSSFQL 123

  Fly   134 VKAFAQLIK------ERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLR 192
            |..|...::      :.:|.|.||:|||||:....:.|.:|::...|.|::|.|.||.||||.||
plant   124 VLKFRSSLEQWLFESDLHSSVQLLVNNAGILATSSRPTVEGFDRMIATNYVGAFSLTKLLLPLLR 188

  Fly   193 AAGKEGRNSRIVNVSSCVN---LIGRINYKDING-----TKHYYPGTAYSQSKLAQILFT--RHL 247
            .:...   ||:|||:|..:   ..||.:...:.|     :|.|.....|..|||..:||:  .|.
plant   189 NSPVP---SRVVNVTSFTHRSAFTGRFDMDSVTGVNFSRSKQYPCARIYEYSKLCLLLFSYELHR 250

  Fly   248 QTLLDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPI-----FKKL-FFKTPERGSRTVVFAAI-D 305
            |..|..:..|:.|..|.||.|.|::. |...:.:.:     .|.| ..::||..:.:|:.||: .
plant   251 QLHLMDDSHHISVVAVDPGAVKTNIM-HELPSYIQVIAFCGLKILGLMQSPEDAAESVIDAALAP 314

  Fly   306 PSIEGQ---GGTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLL-KIQQ 349
            |.|.|:   ||..:.:...      :..|...::|:..||.:. ::||
plant   315 PEISGKYFFGGRTIESSTL------SSDPKMAKELWDTSCLIFNELQQ 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 84/300 (28%)
NADB_Rossmann 67..338 CDD:304358 81/294 (28%)
AT5G04070NP_196027.3 PRK06197 60..347 CDD:235737 82/297 (28%)
NADB_Rossmann 60..344 CDD:304358 81/294 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1164708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.