DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and AT4G24050

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_194136.1 Gene:AT4G24050 / 828505 AraportID:AT4G24050 Length:332 Species:Arabidopsis thaliana


Alignment Length:278 Identity:90/278 - (32%)
Similarity:134/278 - (48%) Gaps:20/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKSV 134
            |||||...|||......|......::...|:.|.||.|...||. ...:.:::..:||:..:.||
plant    37 AVITGATSGIGAETARVLAKRGARLIFPARNVKAAEEAKERIVS-EFPETEIVVMKLDLSSIASV 100

  Fly   135 KAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLL-PQLRAAGKEG 198
            :.|....:.....::||:||||.:.....::.||.|..||.|:|||||||:||| ..::.|.:.|
plant   101 RNFVADFESLDLPLNLLINNAGKLAHEHAISEDGIEMTFATNYLGHFLLTNLLLNKMIQTAEETG 165

  Fly   199 RNSRIVNVSSCV------NLIGRINYKDINGTKHYYPGT-AYSQSKLAQILFTRHLQTLLDAEKS 256
            ...|||||:|.:      :||..:..  |:..|..:..| ||:.||||.:|.|:.|.:.|....:
plant   166 VQGRIVNVTSGIHGWFSGDLIEYLRL--ISQPKCQFDATRAYALSKLANVLHTKELSSRLQKIGA 228

  Fly   257 HVQVNVVHPGIVDTDLF---EHSATTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSN 318
            :|.||.||||:|.|.|.   |...|..|........||..:.:.|..:.|.:|.:....|.|.::
plant   229 NVTVNCVHPGVVRTRLTRDREGLLTDLVFFLASKLVKTVPQAAATTCYVATNPRLVNVSGKYFTD 293

  Fly   319 ------GGKGPFHPDAKK 330
                  .|.|....:|.|
plant   294 CNETTPSGLGTNSSEATK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 90/278 (32%)
NADB_Rossmann 67..338 CDD:304358 90/278 (32%)
AT4G24050NP_194136.1 PRK06197 36..319 CDD:235737 90/278 (32%)
retinol-DH_like_SDR_c_like 36..313 CDD:212492 90/278 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.