DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Tic32-IVa

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_849428.1 Gene:Tic32-IVa / 828442 AraportID:AT4G23430 Length:322 Species:Arabidopsis thaliana


Alignment Length:299 Identity:97/299 - (32%)
Similarity:143/299 - (47%) Gaps:25/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AVITGGNRGIGLRIVEKLLACDMTVVMGVRD----PKIAETAVASIVDLNATKGKLICEQLDVGD 130
            |::||.:.|||:.....|....:.|||.||:    .|:.|..|..:     ...||...:||:..
plant    32 AIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQV-----PGAKLDVMELDLSS 91

  Fly   131 LKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAG 195
            ::||:.||...|.....::||:||||||..||.|:.|..|..||.|.|||||||.|||..:::..
plant    92 MQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKLLLDTMKSTS 156

  Fly   196 KEG-RNSRIVNVSSCVNLIGRINYKD------INGTKHYYPGTAYSQSKLAQILFTRHLQTLLDA 253
            :|. |..||||:||..:   |.:|.:      ||....|....||.||||..:|....|...|..
plant   157 RESKREGRIVNLSSEAH---RFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHANELTKQLKE 218

  Fly   254 EKSHVQVNVVHPGIVDTDL---FEHSATTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTY 315
            :..::..|.:|||.:.|:|   |......:|....|...|:..:|:.|..:.|::|.:.|..|.|
plant   219 DGVNITANSLHPGAIMTNLGRYFNPYLAVAVGAVAKYILKSVPQGAATTCYVALNPQVAGVSGEY 283

  Fly   316 LSNGGKGPFHPDAKKPAKCEQLFQFSCDLLKIQQYGNGE 354
            ..:.......|..|.....::::.||..|...|   :||
plant   284 FQDSNIAKPLPLVKDTELAKKVWDFSTKLTDSQ---SGE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 93/287 (32%)
NADB_Rossmann 67..338 CDD:304358 91/281 (32%)
Tic32-IVaNP_849428.1 retinol-DH_like_SDR_c_like 29..306 CDD:212492 91/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.