DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Wwox

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_062519.2 Gene:Wwox / 80707 MGIID:1931237 Length:414 Species:Mus musculus


Alignment Length:270 Identity:81/270 - (30%)
Similarity:129/270 - (47%) Gaps:35/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            ::.::||.|.|||....:........|::..|:...|..||:.|:: ...|.|:....||:..|:
Mouse   125 KVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILE-EWHKAKVEAMTLDLAVLR 188

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            ||:.||:..|.:...:.:|:.|||....|:.||.||.|:.|.:|.||||.|..||...|..:.. 
Mouse   189 SVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSP- 252

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGT-------------KHYYPGTAYSQSKLAQILFTRHLQT 249
               :|::.|||..:     .:.|||.:             ..|:...||::|||..|||:..|..
Mouse   253 ---ARVIVVSSESH-----RFTDINDSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHR 309

  Fly   250 LLDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKKL------FFKTPERGSRTVVFAAIDPSI 308
            .|...  .|..|.||||    ::...:...:..::|.|      |.|:.::|:.|.|:.|:.|.:
Mouse   310 RLSPR--GVTSNAVHPG----NMMYSAIHRNSWVYKLLFTLARPFTKSMQQGAATTVYCAVAPEL 368

  Fly   309 EGQGGTYLSN 318
            ||.||.|.:|
Mouse   369 EGLGGMYFNN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 81/270 (30%)
NADB_Rossmann 67..338 CDD:304358 81/270 (30%)
WwoxNP_062519.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 19..47 CDD:238122
Nuclear localization signal 50..55
WW 60..90 CDD:238122
PRK06196 107..404 CDD:235736 81/270 (30%)
human_WWOX_like_SDR_c-like 124..407 CDD:187669 81/270 (30%)
Interaction with MAPT. /evidence=ECO:0000269|PubMed:15126504 125..414 81/270 (30%)
Mediates targeting to the mitochondria 209..273 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.