DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and si:dkey-174n20.1

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005165244.1 Gene:si:dkey-174n20.1 / 796174 ZFINID:ZDB-GENE-030131-7890 Length:308 Species:Danio rerio


Alignment Length:285 Identity:88/285 - (30%)
Similarity:148/285 - (51%) Gaps:17/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            :..:|||||.|||......|......|::..||.:.|..||..|...:.....|..| :|:.:::
Zfish    35 KTVLITGGNSGIGKETAVALAMRGARVIIACRDEEKARKAVREIKARSHNMNVLHME-VDLANMR 98

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            |::.|::...::..::|:|:|||| |......|.|.:...|.:|.|||||||:||||:|    ||
Zfish    99 SIREFSKTFLQKEKRLDILINNAG-MPGVLDWTDDNFSMCFGVNHLGHFLLTNLLLPRL----KE 158

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNV 262
            ...||::|::.......::|::|:|  .:.:|...|.:||||.|.||:.|..::  |...|....
Zfish   159 SSPSRVINLTCSSYKYQKLNFQDLN--YNLFPFFTYCRSKLANIYFTQELARMM--EGKGVTAYA 219

  Fly   263 VHPGIVDTDLFEHSAT-----TSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKG 322
            ||||.|.:....|.:.     ..|.:|  :||.:.|.|::|||:.|:...:..:.|.|.::....
Zfish   220 VHPGYVRSRWTCHFSVLYQILAQVVMF--MFFVSCEAGAQTVVYCAVSDEVLPRNGGYFTDCRPA 282

  Fly   323 PFHPDAKKPAKCEQLFQFSCDLLKI 347
            |....|:.....::|::.|..|:|:
Zfish   283 PLKAFARDSGVAKKLWEASERLVKL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 86/280 (31%)
NADB_Rossmann 67..338 CDD:304358 84/274 (31%)
si:dkey-174n20.1XP_005165244.1 PRK06197 28..304 CDD:235737 86/280 (31%)
NADB_Rossmann 34..301 CDD:304358 85/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.