Sequence 1: | NP_001286630.1 | Gene: | CG11200 / 37301 | FlyBaseID: | FBgn0034500 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082224.1 | Gene: | 1700003E16Rik / 71837 | MGIID: | 1919087 | Length: | 598 | Species: | Mus musculus |
Alignment Length: | 308 | Identity: | 66/308 - (21%) |
---|---|---|---|
Similarity: | 101/308 - (32%) | Gaps: | 90/308 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 DPKIAETAVASIV---------DLNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNA 155
Fly 156 GIMFAPFKLTADGYESHFAINFLGHFLL--THLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINY 218
Fly 219 KDINGTKHYYPGTAYSQSKL--AQILFTR--HLQTLLDAEKSHVQVNVVHP--GIVDTDLFEH-- 275
Fly 276 ------------SATTSVPIFKKLFFKTPERG---------SRTVVFAAI--DPSIE-------- 309
Fly 310 GQGGTYLSNG----GKGPFHPD------------AKKPA----KCEQL 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11200 | NP_001286630.1 | PRK06196 | 56..344 | CDD:235736 | 66/308 (21%) |
NADB_Rossmann | 67..338 | CDD:304358 | 66/308 (21%) | ||
1700003E16Rik | NP_082224.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | ||
DUF4639 | 6..571 | CDD:292118 | 66/308 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 151..190 | 2/5 (40%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 222..241 | 4/20 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 366..396 | 4/29 (14%) | |||
LamG | <436..>463 | CDD:304605 | 6/26 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 551..571 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1208 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |