DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Dhrs13

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_899109.2 Gene:Dhrs13 / 70451 MGIID:1917701 Length:376 Species:Mus musculus


Alignment Length:307 Identity:97/307 - (31%)
Similarity:147/307 - (47%) Gaps:23/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGIVGLVHDAQYKARDRVALYKQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETA 107
            ||...||:....||.....:.....|..|:||.|.|||.....:|......||:..|.   .|..
Mouse    12 LGAYVLVYYNLVKAPSCGGIGSLRGRTVVVTGANSGIGKMTALELARRGARVVLACRS---RERG 73

  Fly   108 VASIVDLNATKG--KLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYE 170
            .|:..||....|  ::|...||:..|.||:|||........::|:|::||||  :....|.:.:.
Mouse    74 EAAAFDLRQESGNNEVIFMALDLASLASVQAFATAFLSSEPRLDVLIHNAGI--SSCGRTRETFN 136

  Fly   171 SHFAINFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKDIN----GTKHYYPGT 231
            ....:|.:|.|||||||||:||:...    ||:|.|||..:..||:::..::    |.:...  .
Mouse   137 LLLRVNHVGPFLLTHLLLPRLRSCAP----SRVVIVSSAAHRRGRLDFTRLDCPVVGWQQEL--R 195

  Fly   232 AYSQSKLAQILFTRHLQTLLDAEKSHVQVNVVHPGIVDTDLF-EHSATTSVPIFKK---LFFKTP 292
            ||:.||||.:||.|.|.|.|  |.:.|.....|||.|:::|| .|......||.:.   |..:.|
Mouse   196 AYADSKLANVLFARELATQL--EGTGVTCYAAHPGPVNSELFLRHLPGWLRPILRPLAWLVLRAP 258

  Fly   293 ERGSRTVVFAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQ 339
            :.|::|.::.|:...||...|.|.:|.......|.|:.....::|::
Mouse   259 QGGAQTPLYCALQEGIEPLSGRYFANCHVEEVSPAARDDQAAQRLWK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 92/294 (31%)
NADB_Rossmann 67..338 CDD:304358 90/280 (32%)
Dhrs13NP_899109.2 PRK06197 31..312 CDD:235737 91/288 (32%)
retinol-DH_like_SDR_c_like 36..304 CDD:212492 90/280 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.