DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and RDH14

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_065956.1 Gene:RDH14 / 57665 HGNCID:19979 Length:336 Species:Homo sapiens


Alignment Length:366 Identity:126/366 - (34%)
Similarity:174/366 - (47%) Gaps:76/366 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LGTLLWIF---FVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYL---GIVGLVHDAQYKARDRV 60
            ||..||:.   |||               |          |.|.|   |..||:|          
Human    13 LGGALWLAARRFVG---------------P----------RVQRLRRGGDPGLMH---------- 42

  Fly    61 ALYKQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASI-VDLNATK------ 118
                  .:..:|||.|.|:|.....:||.....|:||.||...||.|...: .:|....      
Human    43 ------GKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAEEAAGQLRRELRQAAECGPEP 101

  Fly   119 -----GKLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFL 178
                 |:||..:||:..|:||:||.|.:.:...::|:|:|||||...|:..|.||:|..|.:|.|
Human   102 GVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIFQCPYMKTEDGFEMQFGVNHL 166

  Fly   179 GHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILF 243
            ||||||:|||..|:::..    ||||.|||.:...|.||:.|:|..:.|.....||:||||.|||
Human   167 GHFLLTNLLLGLLKSSAP----SRIVVVSSKLYKYGDINFDDLNSEQSYNKSFCYSRSKLANILF 227

  Fly   244 TRHLQTLLDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKK--------LFFKTPERGSRTVV 300
            ||.|...|  |.::|.|||:|||||.|:|..|   ..:|:..|        .|||||..|::|.:
Human   228 TRELARRL--EGTNVTVNVLHPGIVRTNLGRH---IHIPLLVKPLFNLVSWAFFKTPVEGAQTSI 287

  Fly   301 FAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFS 341
            :.|..|.:||..|.|..:..:....|.|...:...:|:..|
Human   288 YLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDIS 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 111/306 (36%)
NADB_Rossmann 67..338 CDD:304358 109/290 (38%)
RDH14NP_065956.1 retinol-DH_like_SDR_c 43..328 CDD:212495 110/293 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.