DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and dhrs12

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001070025.1 Gene:dhrs12 / 556393 ZFINID:ZDB-GENE-060929-1134 Length:318 Species:Danio rerio


Alignment Length:266 Identity:80/266 - (30%)
Similarity:129/266 - (48%) Gaps:26/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            |..:|||.|.|||.....::.....||.:..|:...||.|...||:.:.::...: ..:|:...:
Zfish    41 RSFIITGANSGIGKAAAYEIAKRGGTVHLVCRNKDRAEEARKDIVEQSKSENVHV-HLVDMSSPR 104

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            .|..||....:.:: :.:|:||||.|....:||.||.|.:||.|.||.::||..|:|.|    |.
Zfish   105 KVWEFASGFSQNHN-LHVLINNAGCMVNQRELTEDGLEKNFATNTLGTYILTTALIPTL----KR 164

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGT-AYSQSKLAQILFTRHLQTLLDAEKSHVQVN 261
            ..|.|::.|||...|:.::|.:|:...|..:.|| ||:|:|..|::.|....|    :...:..:
Zfish   165 SENPRVITVSSGGMLVQKLNVEDLQFEKGSFDGTMAYAQNKRQQVIMTEQWAT----QHKEIHFS 225

  Fly   262 VVHPGIVDTDLFEHSATTSVPIF---KKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGP 323
            .:|||..||.    :..:|:|.|   .|...:|..:|:.|||:.|:..:...|        ..|.
Zfish   226 SMHPGWADTP----AVRSSMPDFYEKMKNKLRTEAQGADTVVWLAVSDAASRQ--------PSGL 278

  Fly   324 FHPDAK 329
            |..|.|
Zfish   279 FFQDRK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 80/266 (30%)
NADB_Rossmann 67..338 CDD:304358 80/266 (30%)
dhrs12NP_001070025.1 FabG 39..273 CDD:223959 75/245 (31%)
NADB_Rossmann 40..293 CDD:304358 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.