DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and rdh14

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001017231.1 Gene:rdh14 / 549985 XenbaseID:XB-GENE-1018384 Length:323 Species:Xenopus tropicalis


Alignment Length:282 Identity:109/282 - (38%)
Similarity:158/282 - (56%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            :..:|||.|.|||.....:|:..:..|::..||...||.|.|.:......:|:::.:|||:|.|:
 Frog    43 KTVIITGANCGIGKATAAELVKQEARVILACRDQGRAEEAAAELRREAGERGEIVIKQLDLGSLQ 107

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            ||:.|.|.:.:...::|:|:||||:...|:..|.||:|..|.:|.||||||||.||..|:::.. 
 Frog   108 SVRRFCQEVLKEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTHHLLGLLKSSAP- 171

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNV 262
               ||||.|||.:...|.||:.|:|..|.|.....||:||||.|||||.|.:.|  |.:.|.||.
 Frog   172 ---SRIVVVSSKLYKYGEINFDDLNSEKSYSRSFGYSRSKLANILFTRELASRL--EGTGVTVNA 231

  Fly   263 VHPGIVDTDLFEHSATTSVPIFKK--------LFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNG 319
            :|||||.|:|..|   .::||..|        .|||:||.|::|.::.|..|.:||..|:|..|.
 Frog   232 LHPGIVRTNLGRH---INIPILIKPLFNVVSWAFFKSPEEGAQTSIYLASSPEVEGVSGSYFGNS 293

  Fly   320 GKGPFHPDAKKPAKCEQLFQFS 341
            .:....|.|.......:|:..|
 Frog   294 KEEELLPKAMDDLVARKLWDIS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 109/282 (39%)
NADB_Rossmann 67..338 CDD:304358 107/277 (39%)
rdh14NP_001017231.1 NADB_Rossmann 42..315 CDD:389744 108/280 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.