DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Rdh14

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:357 Identity:123/357 - (34%)
Similarity:179/357 - (50%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LGTLLWIFFVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYLGIVGLVHDAQYKARDRVALYKQP 66
            ||..||       |.|..||.::.:            |.|..|..||:|                
  Rat    14 LGGALW-------LAARRFSGSSGQ------------RRQGGGDPGLMH---------------- 43

  Fly    67 DRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASI---------VDLNATKGKLI 122
            .:..:|||.|.|:|.....:||.....|:||.||...||.|...:         :..:||.|:|:
  Rat    44 GKTVLITGANSGLGRATAGELLRLGARVIMGCRDRARAEEAAGQLRQELGQAGGLGPDATDGQLV 108

  Fly   123 CEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLL 187
            .::||:..|:||:||.|.:.:...::|:|:||||:...|:..|.||:|..|.:|.|||||||:||
  Rat   109 VKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFQCPYTKTEDGFEMQFGVNHLGHFLLTNLL 173

  Fly   188 LPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLD 252
            |..|:::..    ||||.|||.:...|.||::|:|..:.|.....||:||||.|||||.|...| 
  Rat   174 LGLLKSSAP----SRIVVVSSKLYKYGDINFEDLNSEQSYNKSFCYSRSKLANILFTRELAHRL- 233

  Fly   253 AEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKK--------LFFKTPERGSRTVVFAAIDPSIE 309
             |.::|.|||:|||||.|:|..|   ..:|:..:        .|||||..|::|.::.|..|.:|
  Rat   234 -EGTNVTVNVLHPGIVRTNLGRH---IHIPLLARPLFNLVSWAFFKTPLEGAQTSIYLASSPDVE 294

  Fly   310 GQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFS 341
            |..|.|..:..:....|.|...:...:|:..|
  Rat   295 GVSGRYFGDCKEEELLPKAMDESVARKLWDIS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 109/303 (36%)
NADB_Rossmann 67..338 CDD:304358 107/287 (37%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 110/309 (36%)
NADB_Rossmann 44..326 CDD:304358 108/290 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.